Lineage for d1c1da2 (1c1d A:1-148)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890284Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 2890400Protein Phenylalanine dehydrogenase [53233] (1 species)
  7. 2890401Species Rhodococcus sp., M4 [TaxId:1831] [53234] (4 PDB entries)
  8. 2890402Domain d1c1da2: 1c1d A:1-148 [33918]
    Other proteins in same PDB: d1c1da1, d1c1db1
    complexed with ipa, k, na, nai, phe, po4

Details for d1c1da2

PDB Entry: 1c1d (more details), 1.25 Å

PDB Description: l-phenylalanine dehydrogenase structure in ternary complex with nadh and l-phenylalanine
PDB Compounds: (A:) l-phenylalanine dehydrogenase

SCOPe Domain Sequences for d1c1da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1da2 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]}
sidsalnwdgemtvtrfdamtgahfvirldstqlgpaaggtraaqysnladaltdagkla
gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
tnsadmdtlndttefvfgrslerggags

SCOPe Domain Coordinates for d1c1da2:

Click to download the PDB-style file with coordinates for d1c1da2.
(The format of our PDB-style files is described here.)

Timeline for d1c1da2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c1da1