Lineage for d5nvvk1 (5nvv K:17-112)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189359Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2189360Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2189361Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2189438Protein Elongin C [54699] (3 species)
  7. 2189441Species Human (Homo sapiens) [TaxId:9606] [54700] (41 PDB entries)
  8. 2189495Domain d5nvvk1: 5nvv K:17-112 [339170]
    Other proteins in same PDB: d5nvva_, d5nvvb2, d5nvvc_, d5nvvd_, d5nvve2, d5nvvf_, d5nvvg_, d5nvvh2, d5nvvi_, d5nvvj_, d5nvvk2, d5nvvl_
    automated match to d1lm8c_
    complexed with 9bt

Details for d5nvvk1

PDB Entry: 5nvv (more details), 2.1 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-4-hydroxy-1-((s)-2-(2- hydroxyacetamido)-3,3-dimethylbutanoyl)-n-(4-(4-methylthiazol-5-yl) benzyl)pyrrolidine-2-carboxamide (ligand 3)
PDB Compounds: (K:) Elongin-C

SCOPe Domain Sequences for d5nvvk1:

Sequence, based on SEQRES records: (download)

>d5nvvk1 d.42.1.1 (K:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d5nvvk1 d.42.1.1 (K:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlstnevnfreipshvlskvcmyftykvrytn
ssteipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d5nvvk1:

Click to download the PDB-style file with coordinates for d5nvvk1.
(The format of our PDB-style files is described here.)

Timeline for d5nvvk1: