Lineage for d5nx5a_ (5nx5 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014347Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2014348Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2014755Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2014756Protein automated matches [196409] (37 species)
    not a true protein
  7. 2014888Species Streptomyces clavuligerus [TaxId:1901] [339165] (2 PDB entries)
  8. 2014889Domain d5nx5a_: 5nx5 A: [339166]
    automated match to d5dz2a_
    complexed with 0fv, cl, gol, mg, po4

Details for d5nx5a_

PDB Entry: 5nx5 (more details), 1.82 Å

PDB Description: crystal structure of linalool/nerolidol synthase from streptomyces clavuligerus in complex with 2-fluorogeranyl diphosphate
PDB Compounds: (A:) pentalenene synthase

SCOPe Domain Sequences for d5nx5a_:

Sequence, based on SEQRES records: (download)

>d5nx5a_ a.128.1.0 (A:) automated matches {Streptomyces clavuligerus [TaxId: 1901]}
rvspdlarararhldwvhamdlvrgeearrryefscvadigaygyphatgadldlcvdvl
gwtflfddqfdagdgrerdalavcaeltdllwkgtaataasppivvafsdcwermragms
dawrrrtvhewvdylagwptkladrahgavldpaahlrarhrticcrplfalaervggye
vprrawhssrldgmrfttsdavigmnelhsfekdraqghanlvlslvhhggltgpeavtr
vcdlvqgsiesflrlrsglpelgralgvegavldryadalsafcrgyhdwgr

Sequence, based on observed residues (ATOM records): (download)

>d5nx5a_ a.128.1.0 (A:) automated matches {Streptomyces clavuligerus [TaxId: 1901]}
rvspdlarararhldwvhamdlvrgeearrryefscvadigaygyphatgadldlcvdvl
gwtflfddqfdrerdalavcaeltdllwkgtaataasppivvafsdcwermragmsdawr
rrtvhewvdylagwptkladrahgavldpaahlrarhrticcrplfalaervggyevprr
awhssrldgmrfttsdavigmnelhsfekdraqhanlvlslvhhggltgpeavtrvcdlv
qgsiesflrlrsglpelgralgvegavldryadalsafcrgyhdwgr

SCOPe Domain Coordinates for d5nx5a_:

Click to download the PDB-style file with coordinates for d5nx5a_.
(The format of our PDB-style files is described here.)

Timeline for d5nx5a_: