Lineage for d5nw2b1 (5nw2 B:17-112)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945444Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2945540Protein Elongin C [54699] (3 species)
  7. 2945543Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries)
  8. 2945606Domain d5nw2b1: 5nw2 B:17-112 [339162]
    Other proteins in same PDB: d5nw2a_, d5nw2b2, d5nw2c_, d5nw2d_, d5nw2e2, d5nw2f_, d5nw2g_, d5nw2h2, d5nw2i_, d5nw2j_, d5nw2k2, d5nw2l_
    automated match to d1lm8c_
    complexed with 9b8

Details for d5nw2b1

PDB Entry: 5nw2 (more details), 2.2 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-1-((s)-3,3-dimethyl-2-(oxetane- 3-carboxamido)butanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl) pyrrolidine-2-carboxamide (ligand 19)
PDB Compounds: (B:) Elongin-C

SCOPe Domain Sequences for d5nw2b1:

Sequence, based on SEQRES records: (download)

>d5nw2b1 d.42.1.1 (B:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d5nw2b1 d.42.1.1 (B:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns
steipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d5nw2b1:

Click to download the PDB-style file with coordinates for d5nw2b1.
(The format of our PDB-style files is described here.)

Timeline for d5nw2b1: