SCOP 1.65: Domain d1leha2: 1leh A:1-134

Lineage for d1leha2 (1leh A:1-134)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)

5. Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
   dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet

6. Protein Leucine dehydrogenase [53231] (1 species)

7. Species Bacillus sphaericus [TaxId:1421] [53232] (1 PDB entry)

8. Domain d1leha2: 1leh A:1-134 [33916]
   Other proteins in same PDB: d1leha1, d1lehb1

Details for d1leha2

PDB Entry: 1leh, 2.2 Å

PDB Description: leucine dehydrogenase from bacillus sphaericus

SCOP Domain Sequences for d1leha2:

Sequence; same for both SEQRES and ATOM records:

>d1leha2 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus sphaericus}
meifkymekydyeqlvfcqdeasglkaviaihdttlgpalggarmwtynaeeeaiedalr
largmtyknaaaglnlgggktviigdpfadknedmfralgrfiqglngryitaedvgttv
ddmdlihqetdyvt

Timeline for d1leha2:

• d1leha2 first appeared (with stable ids) in SCOP 1.55
  
• d1leha2 appears in SCOP 1.63
  
• d1leha2 appears in SCOP 1.67
  
• d1leha2 appears in the current release, SCOPe 2.08