Lineage for d5nvyd_ (5nvy D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2501112Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2501137Protein Elongin B [54246] (2 species)
  7. 2501138Species Human (Homo sapiens) [TaxId:9606] [54247] (49 PDB entries)
  8. 2501264Domain d5nvyd_: 5nvy D: [339153]
    Other proteins in same PDB: d5nvyb1, d5nvyb2, d5nvyc_, d5nvye1, d5nvye2, d5nvyf_, d5nvyh1, d5nvyh2, d5nvyi_, d5nvyk1, d5nvyk2, d5nvyl_
    automated match to d1lqba_
    complexed with 9b5

Details for d5nvyd_

PDB Entry: 5nvy (more details), 2.9 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-acetamidopropanoyl)-4- hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl) pyrrolidine-2-carboxamide (ligand 11)
PDB Compounds: (D:) Elongin-B

SCOPe Domain Sequences for d5nvyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nvyd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d5nvyd_:

Click to download the PDB-style file with coordinates for d5nvyd_.
(The format of our PDB-style files is described here.)

Timeline for d5nvyd_: