Lineage for d5lxsf1 (5lxs F:1-76)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120504Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2120505Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2120788Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2120789Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2120790Species Chicken (Gallus gallus) [TaxId:9031] [311384] (51 PDB entries)
  8. 2120808Domain d5lxsf1: 5lxs F:1-76 [339150]
    Other proteins in same PDB: d5lxsa1, d5lxsa2, d5lxsb1, d5lxsb2, d5lxsc1, d5lxsc2, d5lxsd1, d5lxsd2, d5lxse_, d5lxsf2, d5lxsf3
    automated match to d3tiia1
    complexed with 7ao, acp, ca, gdp, gtp, mes, mg

Details for d5lxsf1

PDB Entry: 5lxs (more details), 2.2 Å

PDB Description: tubulin-ks-1-199-32 complex
PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d5lxsf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lxsf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d5lxsf1:

Click to download the PDB-style file with coordinates for d5lxsf1.
(The format of our PDB-style files is described here.)

Timeline for d5lxsf1: