Class a: All alpha proteins [46456] (289 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (2 proteins) |
Protein Stathmin 4 [101496] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (72 PDB entries) |
Domain d5lxse_: 5lxs E: [339149] Other proteins in same PDB: d5lxsa1, d5lxsa2, d5lxsb1, d5lxsb2, d5lxsc1, d5lxsc2, d5lxsd1, d5lxsd2, d5lxsf1, d5lxsf2, d5lxsf3 automated match to d4i55e_ complexed with 7ao, acp, ca, gdp, gtp, mes, mg |
PDB Entry: 5lxs (more details), 2.2 Å
SCOPe Domain Sequences for d5lxse_:
Sequence, based on SEQRES records: (download)
>d5lxse_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelkeea
>d5lxse_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk eea
Timeline for d5lxse_: