Lineage for d5nvxc_ (5nvx C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2364769Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2364948Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2364949Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2364950Protein VHL [49470] (1 species)
  7. 2364951Species Human (Homo sapiens) [TaxId:9606] [49471] (38 PDB entries)
  8. 2364998Domain d5nvxc_: 5nvx C: [339107]
    Other proteins in same PDB: d5nvxa_, d5nvxb1, d5nvxb2, d5nvxd_, d5nvxe1, d5nvxe2, d5nvxg_, d5nvxh1, d5nvxh2, d5nvxj_, d5nvxk1, d5nvxk2
    automated match to d1lqbc_
    complexed with 4yy

Details for d5nvxc_

PDB Entry: 5nvx (more details), 2.2 Å

PDB Description: pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-(1- fluorocyclopropanecarboxamido)-3,3-dimethylbutanoyl)-4-hydroxy-n-(4- (4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 10)
PDB Compounds: (C:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d5nvxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nvxc_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerlt

SCOPe Domain Coordinates for d5nvxc_:

Click to download the PDB-style file with coordinates for d5nvxc_.
(The format of our PDB-style files is described here.)

Timeline for d5nvxc_: