Lineage for d1hwya2 (1hwy A:1-208)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) 
Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins) 
Protein Glutamate dehydrogenase [53225] (6 species) 
Species Cow (Bos taurus) [TaxId:9913] [53230] (3 PDB entries) 
Domain d1hwya2: 1hwy A:1-208 [33910]
Other proteins in same PDB: d1hwya1, d1hwyb1, d1hwyc1, d1hwyd1, d1hwye1, d1hwyf1
Details for d1hwya2
PDB Entry: 1hwy (more details), 3.2 Å
PDB Description: bovine glutamate dehydrogenase complexed with nad and 2-oxoglutarate
SCOP Domain Sequences for d1hwya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hwya2 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (Bos taurus)}
adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
dtyastighydinahacvtgkpisqggi
SCOP Domain Coordinates for d1hwya2:
Click to download the PDB-style file with coordinates for d1hwya2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hwya2:
View in 3D
