SCOPe 2.08: Domain d5n5db1: 5n5d B:1-222

Lineage for d5n5db1 (5n5d B:1-222)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (87 species)
   not a true protein

7. Species Streptomyces regensis [TaxId:68263] [339082] (1 PDB entry)

8. Domain d5n5db1: 5n5d B:1-222 [339086]
   Other proteins in same PDB: d5n5da2, d5n5db2
   automated match to d3c3pb_
   complexed with bu3, gol, sam, so4

Details for d5n5db1

PDB Entry: 5n5d, 1.55 Å

PDB Description: crystal structure of the o-methyltransferase tomg from streptomyces achromogenes involved in tomaymycin synthesis in complex with sam

PDB Compounds: (B:) Methyltransferase

SCOPe Domain Sequences for d5n5db1:

Sequence; same for both SEQRES and ATOM records:

>d5n5db1 c.66.1.0 (B:1-222) automated matches {Streptomyces regensis [TaxId: 68263]}
meqerwnsvdvyfssllvkedealskaaqahrefdlpdlavsapqgkllhllarlrqarr
ileigtfggyssiwlaralppdgrlvtiewersfaesaasrlaeagvahlveqhvgrald
ilptldrpgtapfdmvfvdankpdipeyftwalklsrpgavvvvdnvvlggavtdpdhpd
agvqgvrrfhemlagrsdvtatsiqtvgtkgydgftlalvtg

Timeline for d5n5db1:

• d5n5db1 first appeared in SCOPe 2.06
  
• d5n5db1 appears in SCOPe 2.07