Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (87 species) not a true protein |
Species Streptomyces regensis [TaxId:68263] [339082] (1 PDB entry) |
Domain d5n5db1: 5n5d B:1-222 [339086] Other proteins in same PDB: d5n5da2, d5n5db2 automated match to d3c3pb_ complexed with bu3, gol, sam, so4 |
PDB Entry: 5n5d (more details), 1.55 Å
SCOPe Domain Sequences for d5n5db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n5db1 c.66.1.0 (B:1-222) automated matches {Streptomyces regensis [TaxId: 68263]} meqerwnsvdvyfssllvkedealskaaqahrefdlpdlavsapqgkllhllarlrqarr ileigtfggyssiwlaralppdgrlvtiewersfaesaasrlaeagvahlveqhvgrald ilptldrpgtapfdmvfvdankpdipeyftwalklsrpgavvvvdnvvlggavtdpdhpd agvqgvrrfhemlagrsdvtatsiqtvgtkgydgftlalvtg
Timeline for d5n5db1: