Lineage for d5knyd_ (5kny D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2892061Species Mycobacterium tuberculosis [TaxId:83332] [272972] (5 PDB entries)
  8. 2892079Domain d5knyd_: 5kny D: [339077]
    automated match to d4rhua_
    complexed with mg, ypg

Details for d5knyd_

PDB Entry: 5kny (more details), 2.91 Å

PDB Description: crystal structure of mycobacterium tuberculosis hypoxanthine guanine phosphoribosyltransferase in complex with (3-((3r,4r)-3-(guanin-9- yl)-4-((s)-2-hydroxy-2-phosphonoethoxy)pyrrolidin-1-yl)-3-oxopropyl) phosphonic acid
PDB Compounds: (D:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d5knyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5knyd_ c.61.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
lypgdiksvlltaeqiqariaelgeqigndyrelsattgqdlllitvlkgavlfvtdlar
aipvptqfefmavssygsstsssgvvrilkdldrdihgrdvlivedvvdsgltlswlsrn
ltsrnprslrvctllrkpdavhanveiayvgfdipndfvvgygldyderyrdlsyigtld
prv

SCOPe Domain Coordinates for d5knyd_:

Click to download the PDB-style file with coordinates for d5knyd_.
(The format of our PDB-style files is described here.)

Timeline for d5knyd_: