SCOPe 2.06: Domain d5h5la1: 5h5l A:2-77

Lineage for d5h5la1 (5h5l A:2-77)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Nilaparvata lugens [TaxId:108931] [268085] (2 PDB entries)

8. Domain d5h5la1: 5h5l A:2-77 [339058]
   Other proteins in same PDB: d5h5la2, d5h5lb2
   automated match to d2ws2a1
   complexed with edo, gsh, peg

Details for d5h5la1

PDB Entry: 5h5l, 2 Å

PDB Description: structure of prostaglandin synthase d of nilaparvata lugens

PDB Compounds: (A:) Glutathione s-transferase S2

SCOPe Domain Sequences for d5h5la1:

Sequence; same for both SEQRES and ATOM records:

>d5h5la1 c.47.1.0 (A:2-77) automated matches {Nilaparvata lugens [TaxId: 108931]}
ptykltyfnfaglgepirwmlsyldvpfednriereqwptiksttpygqvpvlevdgkqv
cqstaiarylgkkagl

Timeline for d5h5la1:

• d5h5la1 is new in SCOPe 2.06-stable
  
• d5h5la1 appears in SCOPe 2.07
  
• d5h5la1 appears in the current release, SCOPe 2.08