Lineage for d6anja1 (6anj A:134-262)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2773072Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2773073Protein automated matches [190497] (4 species)
    not a true protein
  7. 2773134Species Norway rat (Rattus norvegicus) [TaxId:10116] [189223] (10 PDB entries)
  8. 2773138Domain d6anja1: 6anj A:134-262 [339052]
    Other proteins in same PDB: d6anja2
    automated match to d2k45a_
    complexed with act, ca, tbu

Details for d6anja1

PDB Entry: 6anj (more details), 1.7 Å

PDB Description: synaptotagmin-7, c2a domain
PDB Compounds: (A:) Synaptotagmin-7

SCOPe Domain Sequences for d6anja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6anja1 b.7.1.0 (A:134-262) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
enlgriqfsvgynfqestltvkvmkaqelpakdfsgtsdpfvkiyllpdkkhkletkvkr
knlnphwnetflfegfpyekvvqrilylqvldydrfsrndpigevsiplnkvdltqmqtf
wkdlkpcsd

SCOPe Domain Coordinates for d6anja1:

Click to download the PDB-style file with coordinates for d6anja1.
(The format of our PDB-style files is described here.)

Timeline for d6anja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6anja2