SCOPe 2.07: Domain d1hwzb2: 1hwz B:1-208

Lineage for d1hwzb2 (1hwz B:1-208)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
   dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet

6. Protein Glutamate dehydrogenase [53225] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53230] (8 PDB entries)

8. Domain d1hwzb2: 1hwz B:1-208 [33905]
   Other proteins in same PDB: d1hwza1, d1hwzb1, d1hwzc1, d1hwzd1, d1hwze1, d1hwzf1
   complexed with glu, gtp, ndp

Details for d1hwzb2

PDB Entry: 1hwz, 2.8 Å

PDB Description: bovine glutamate dehydrogenase complexed with nadph, glutamate, and gtp

PDB Compounds: (B:) glutamate dehydrogenase

SCOPe Domain Sequences for d1hwzb2:

Sequence; same for both SEQRES and ATOM records:

>d1hwzb2 c.58.1.1 (B:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
dtyastighydinahacvtgkpisqggi

Timeline for d1hwzb2:

• d1hwzb2 first appeared (with stable ids) in SCOP 1.55
  
• d1hwzb2 appears in SCOPe 2.06
  
• d1hwzb2 does not appear in SCOPe 2.08