SCOP 1.61: Domain d1hwzb2: 1hwz B:1-208

Lineage for d1hwzb2 (1hwz B:1-208)

Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families)
Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
Protein Glutamate dehydrogenase [53225] (7 species)
Species Cow (Bos taurus) [TaxId:9913] [53230] (3 PDB entries)
Domain d1hwzb2: 1hwz B:1-208 [33905]
Other proteins in same PDB: d1hwza1, d1hwzb1, d1hwzc1, d1hwzd1, d1hwze1, d1hwzf1

Details for d1hwzb2

PDB Entry: 1hwz (more details), 2.8 Å

PDB Description: bovine glutamate dehydrogenase complexed with nadph, glutamate, and gtp

SCOP Domain Sequences for d1hwzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwzb2 c.58.1.1 (B:1-208) Glutamate dehydrogenase {Cow (Bos taurus)}
adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
dtyastighydinahacvtgkpisqggi

SCOP Domain Coordinates for d1hwzb2:

Click to download the PDB-style file with coordinates for d1hwzb2.
(The format of our PDB-style files is described here.)

Timeline for d1hwzb2: