Lineage for d5y9aa1 (5y9a A:1-193)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889282Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2889299Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2889300Protein automated matches [193326] (11 species)
    not a true protein
  7. 2889301Species Acinetobacter baumannii [TaxId:575584] [196867] (29 PDB entries)
  8. 2889309Domain d5y9aa1: 5y9a A:1-193 [339042]
    Other proteins in same PDB: d5y9aa2
    automated match to d4qaja_
    protein/RNA complex; complexed with ar3, po4

Details for d5y9aa1

PDB Entry: 5y9a (more details), 1.1 Å

PDB Description: crystal structure of the complex of peptidyl trna hydrolase with a phosphate ion at the substrate binding site and cytarabine at a new ligand binding site at 1.1 a resolution
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d5y9aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y9aa1 c.56.3.0 (A:1-193) automated matches {Acinetobacter baumannii [TaxId: 575584]}
msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
pqamnqinaykpa

SCOPe Domain Coordinates for d5y9aa1:

Click to download the PDB-style file with coordinates for d5y9aa1.
(The format of our PDB-style files is described here.)

Timeline for d5y9aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5y9aa2