Lineage for d5xs3b_ (5xs3 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2030148Domain d5xs3b_: 5xs3 B: [339036]
    Other proteins in same PDB: d5xs3a1, d5xs3a2
    automated match to d1duzb_

Details for d5xs3b_

PDB Entry: 5xs3 (more details), 2.5 Å

PDB Description: crystal structure of hla class i antigen
PDB Compounds: (B:) light chain

SCOPe Domain Sequences for d5xs3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xs3b_ b.1.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfsgdw
sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrd

SCOPe Domain Coordinates for d5xs3b_:

Click to download the PDB-style file with coordinates for d5xs3b_.
(The format of our PDB-style files is described here.)

Timeline for d5xs3b_: