SCOPe 2.07: Domain d5y98a1: 5y98 A:1-193

Lineage for d5y98a1 (5y98 A:1-193)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.0: automated matches [193325] (1 protein)
   not a true family

6. Protein automated matches [193326] (11 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:575584] [196867] (29 PDB entries)

8. Domain d5y98a1: 5y98 A:1-193 [339034]
   Other proteins in same PDB: d5y98a2
   automated match to d4qaja_
   complexed with gol

Details for d5y98a1

PDB Entry: 5y98, 1.36 Å

PDB Description: crystal structure of native unbound peptidyl trna hydrolase from acinetobacter baumannii at 1.36 a resolution

PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d5y98a1:

Sequence; same for both SEQRES and ATOM records:

>d5y98a1 c.56.3.0 (A:1-193) automated matches {Acinetobacter baumannii [TaxId: 575584]}
msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
pqamnqinaykpa

Timeline for d5y98a1:

• d5y98a1 first appeared in SCOPe 2.06
  
• d5y98a1 appears in the current release, SCOPe 2.08