Lineage for d1hwxe2 (1hwx E:1-208)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 587802Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 587803Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 587804Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 587805Protein Glutamate dehydrogenase [53225] (8 species)
  7. 587831Species Cow (Bos taurus) [TaxId:9913] [53230] (5 PDB entries)
  8. 587836Domain d1hwxe2: 1hwx E:1-208 [33902]
    Other proteins in same PDB: d1hwxa1, d1hwxb1, d1hwxc1, d1hwxd1, d1hwxe1, d1hwxf1

Details for d1hwxe2

PDB Entry: 1hwx (more details), 2.5 Å

PDB Description: crystal structure of bovine liver glutamate dehydrogenase complexed with gtp, nadh, and l-glutamic acid

SCOP Domain Sequences for d1hwxe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwxe2 c.58.1.1 (E:1-208) Glutamate dehydrogenase {Cow (Bos taurus)}
adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
dtyastighydinahacvtgkpisqggi

SCOP Domain Coordinates for d1hwxe2:

Click to download the PDB-style file with coordinates for d1hwxe2.
(The format of our PDB-style files is described here.)

Timeline for d1hwxe2: