Lineage for d5w0ca1 (5w0c A:27-489)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 2331534Protein automated matches [190068] (10 species)
    not a true protein
  7. 2331553Species Human (Homo sapiens) [TaxId:9606] [189507] (64 PDB entries)
  8. 2331560Domain d5w0ca1: 5w0c A:27-489 [339008]
    Other proteins in same PDB: d5w0ca2
    automated match to d2vn0a_
    complexed with 9w6, gol, hem

Details for d5w0ca1

PDB Entry: 5w0c (more details), 2 Å

PDB Description: cytochrome p450 (cyp) 2c9 tca007 inhibitor complex
PDB Compounds: (A:) Cytochrome P450 2C9

SCOPe Domain Sequences for d5w0ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w0ca1 a.104.1.1 (A:27-489) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gklppgptplpvignilqigikdisksltnlskvygpvftlyfglkpivvlhgyeavkea
lidlgeefsgrgifplaeranrgfgivfsngkkwkeirrfslmtlrnfgmgkrsiedrvq
eearclveelrktkaspcdptfilgcapcnvicsiifhkrfdykdqqflnlmeklnenik
ilsspwiqicnnfspiidyfpgthnkllknvafmksyilekvkehqesmdmnnpqdfidc
flmkmekekhnqpseftieslentavdlfgagtettsttlryalllllkhpevtakvqee
iervigrnrspcmqdrshmpytdavvhevqryidllptslphavtcdikfrnylipkgtt
ilisltsvlhdnkefpnpemfdphhfldeggnfkkskyfmpfsagkricvgealagmelf
lfltsilqnfnlkslvdpknldttpvvngfasvppfyqlcfip

SCOPe Domain Coordinates for d5w0ca1:

Click to download the PDB-style file with coordinates for d5w0ca1.
(The format of our PDB-style files is described here.)

Timeline for d5w0ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5w0ca2