Lineage for d5tuoc_ (5tuo C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811457Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2811458Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2812758Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2812759Protein automated matches [191011] (16 species)
    not a true protein
  7. 2812794Species Helicobacter pylori [TaxId:85962] [274562] (6 PDB entries)
  8. 2812829Domain d5tuoc_: 5tuo C: [338994]
    automated match to d4ygfg_
    complexed with 1sa, cl, zn

Details for d5tuoc_

PDB Entry: 5tuo (more details), 2.5 Å

PDB Description: crystal structure of the complex of helicobacter pylori alpha-carbonic anhydrase with 5-amino-1,3,4-thiadiazole-2-sulfonamide inhibitor.
PDB Compounds: (C:) Alpha-carbonic anhydrase

SCOPe Domain Sequences for d5tuoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tuoc_ b.74.1.0 (C:) automated matches {Helicobacter pylori [TaxId: 85962]}
kwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkavf
fthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllv
laigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegvaw
fvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr

SCOPe Domain Coordinates for d5tuoc_:

Click to download the PDB-style file with coordinates for d5tuoc_.
(The format of our PDB-style files is described here.)

Timeline for d5tuoc_: