SCOPe 2.08: Domain d5tw0b_: 5tw0 B:

Lineage for d5tw0b_ (5tw0 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein automated matches [190995] (8 species)
   not a true protein

7. Species Thermococcus thioreducens [TaxId:277988] [338977] (2 PDB entries)

8. Domain d5tw0b_: 5tw0 B: [338978]
   automated match to d1g2ia_

Details for d5tw0b_

PDB Entry: 5tw0, 1.96 Å

PDB Description: structure of pfp1 protease from thermococcus thioreducens: small cell h3 crystal form

PDB Compounds: (B:) Peptidase

SCOPe Domain Sequences for d5tw0b_:

Sequence; same for both SEQRES and ATOM records:

>d5tw0b_ c.23.16.2 (B:) automated matches {Thermococcus thioreducens [TaxId: 277988]}
mkvlflsadgfedlelicplhrikeeghevyvasfergkitgkhgysvnvdlafeevgpd
efdalvlpggrapeivrlnekaieitrkmfeagkpvasichgpqilisagvlkgrkgtst
itirddvvnagaewvneevvvdgnwvssrhpgdlyawmrefvkllk

Timeline for d5tw0b_:

• d5tw0b_ first appeared in SCOPe 2.06
  
• d5tw0b_ appears in SCOPe 2.07