Lineage for d5tt3c_ (5tt3 C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2077896Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2077897Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2078811Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2078812Protein automated matches [191011] (13 species)
    not a true protein
  7. 2078844Species Helicobacter pylori [TaxId:85962] [274562] (6 PDB entries)
  8. 2078855Domain d5tt3c_: 5tt3 C: [338967]
    automated match to d4ygfg_
    complexed with cl, ezl, gol, zn

Details for d5tt3c_

PDB Entry: 5tt3 (more details), 2.2 Å

PDB Description: crystal structure of the complex of helicobacter pylori alpha-carbonic anhydrase with ethoxzolamide
PDB Compounds: (C:) Alpha-carbonic anhydrase

SCOPe Domain Sequences for d5tt3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tt3c_ b.74.1.0 (C:) automated matches {Helicobacter pylori [TaxId: 85962]}
tkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkav
ffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrll
vlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegva
wfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr

SCOPe Domain Coordinates for d5tt3c_:

Click to download the PDB-style file with coordinates for d5tt3c_.
(The format of our PDB-style files is described here.)

Timeline for d5tt3c_: