SCOPe 2.06: Domain d5suvb1: 5suv B:1-125

Lineage for d5suvb1 (5suv B:1-125)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
   beta-alpha(3)-beta(2) motif

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families)
   possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)

5. Family d.150.1.0: automated matches [191589] (1 protein)
   not a true family

6. Protein automated matches [191061] (10 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:272831] [275853] (2 PDB entries)

8. Domain d5suvb1: 5suv B:1-125 [338964]
   Other proteins in same PDB: d5suva2, d5suvb2
   automated match to d5cmoa_
   complexed with coa

Details for d5suvb1

PDB Entry: 5suv, 1.75 Å

PDB Description: crystal structure of holo-[acyl-carrier-protein] synthase (acps) from neisseria meningitidis in complex with coenzyme a

PDB Compounds: (B:) Holo-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d5suvb1:

Sequence; same for both SEQRES and ATOM records:

>d5suvb1 d.150.1.0 (B:1-125) automated matches {Neisseria meningitidis [TaxId: 272831]}
miygigtdivslkriirlnkkfgqafagriltpeellefpqagkpvnylakrfaakeafa
kavgtgirgavsfrnigighdalgkpeffygpalskwleeqgisrvslsmsdeedtvlaf
vvaek

Timeline for d5suvb1:

• d5suvb1 is new in SCOPe 2.06-stable
  
• d5suvb1 appears in SCOPe 2.07
  
• d5suvb1 appears in the current release, SCOPe 2.08