Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
Family d.150.1.0: automated matches [191589] (1 protein) not a true family |
Protein automated matches [191061] (10 species) not a true protein |
Species Neisseria meningitidis [TaxId:272831] [275853] (2 PDB entries) |
Domain d5suvb1: 5suv B:1-125 [338964] Other proteins in same PDB: d5suva2, d5suvb2 automated match to d5cmoa_ complexed with coa |
PDB Entry: 5suv (more details), 1.75 Å
SCOPe Domain Sequences for d5suvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5suvb1 d.150.1.0 (B:1-125) automated matches {Neisseria meningitidis [TaxId: 272831]} miygigtdivslkriirlnkkfgqafagriltpeellefpqagkpvnylakrfaakeafa kavgtgirgavsfrnigighdalgkpeffygpalskwleeqgisrvslsmsdeedtvlaf vvaek
Timeline for d5suvb1: