Lineage for d5o30g_ (5o30 G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847324Species Ilumatobacter coccineus [TaxId:1313172] [338929] (4 PDB entries)
  8. 2847335Domain d5o30g_: 5o30 G: [338946]
    automated match to d1ybva_
    complexed with act, gol

Details for d5o30g_

PDB Entry: 5o30 (more details), 2.3 Å

PDB Description: crystal structure of the novel halohydrin dehalogenase hheg
PDB Compounds: (G:) Putative oxidoreductase

SCOPe Domain Sequences for d5o30g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o30g_ c.2.1.0 (G:) automated matches {Ilumatobacter coccineus [TaxId: 1313172]}
nrpvalitmatgyvgpalartmadrgfdlvlhgtagdgtmvgveesfdsqiadlakrgad
vltisdvdlttrtgnqsmiervlerfgrldsaclvtglivtgkfldmtddqwakvkatnl
dmvfhglqavlppmvaagagqcvvftsatggrpdpmvsiyggtragangivravglehar
hgvqvnaigtnymdfpgflkasradgdperramieaqvplrrlgtmdelssvtaglldgs
nrfqtgqffdfsggwga

SCOPe Domain Coordinates for d5o30g_:

Click to download the PDB-style file with coordinates for d5o30g_.
(The format of our PDB-style files is described here.)

Timeline for d5o30g_: