Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Ilumatobacter coccineus [TaxId:1313172] [338929] (4 PDB entries) |
Domain d5o30b_: 5o30 B: [338930] automated match to d1ybva_ complexed with act, gol |
PDB Entry: 5o30 (more details), 2.3 Å
SCOPe Domain Sequences for d5o30b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o30b_ c.2.1.0 (B:) automated matches {Ilumatobacter coccineus [TaxId: 1313172]} enrpvalitmatgyvgpalartmadrgfdlvlhgtagdgtmvgveesfdsqiadlakrga dvltisdvdlttrtgnqsmiervlerfgrldsaclvtglivtgkfldmtddqwakvkatn ldmvfhglqavlppmvaagagqcvvftsatggrpdpmvsiyggtragangivravgleha rhgvqvnaigtnymdfpgflkasradgdperramieaqvplrrlgtmdelssvtaglldg snrfqtgqffdfsggwga
Timeline for d5o30b_: