SCOPe 2.06: Domain d5ls0a_: 5ls0 A:

Lineage for d5ls0a_ (5ls0 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families)

5. Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
   barrel, closed; n=5, S=8

6. Protein Inorganic pyrophosphatase [50326] (7 species)
   eukaryotic enzyme has additional secondary structures at both N- and C-termini

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [257893] (2 PDB entries)

8. Domain d5ls0a_: 5ls0 A: [338907]
   automated match to d4lugb_
   complexed with mg, peg

Details for d5ls0a_

PDB Entry: 5ls0, 1.83 Å

PDB Description: crystal structure of inorganic pyrophosphatase ppa1 from arabidopsis thaliana

PDB Compounds: (A:) Soluble inorganic pyrophosphatase 1

SCOPe Domain Sequences for d5ls0a_:

Sequence; same for both SEQRES and ATOM records:

>d5ls0a_ b.40.5.1 (A:) Inorganic pyrophosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ahpwhdleigpgapqifnvvveitkgskvkyeldkktglikvdrilyssvvyphnygfvp
rtlcedndpidvlvimqepvlpgcflraraiglmpmidqgekddkiiavcvddpeykhyt
dikelpphrlseirrffedykknenkevavndflpsesaveaiqysmdlyaeyil

Timeline for d5ls0a_:

• d5ls0a_ is new in SCOPe 2.06-stable
  
• d5ls0a_ appears in SCOPe 2.07
  
• d5ls0a_ appears in the current release, SCOPe 2.08