Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) |
Family e.19.1.0: automated matches [191636] (1 protein) not a true family |
Protein automated matches [191172] (7 species) not a true protein |
Species Escherichia coli [TaxId:199310] [330683] (3 PDB entries) |
Domain d5lrys_: 5lry S: [338906] Other proteins in same PDB: d5lryl_, d5lrym_ automated match to d3rgws_ complexed with cl, f3s, fco, li, lmt, mg, ni, sf3, sf4, so4; mutant |
PDB Entry: 5lry (more details), 1.4 Å
SCOPe Domain Sequences for d5lrys_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lrys_ e.19.1.0 (S:) automated matches {Escherichia coli [TaxId: 199310]} pripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedii tqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqaa rpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfygq rihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpiq sghgclgcaengfwdrgsfysrv
Timeline for d5lrys_: