Lineage for d5lrys_ (5lry S:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249152Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2249153Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2249298Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 2249299Protein automated matches [191172] (7 species)
    not a true protein
  7. 2249314Species Escherichia coli [TaxId:199310] [330683] (3 PDB entries)
  8. 2249319Domain d5lrys_: 5lry S: [338906]
    Other proteins in same PDB: d5lryl_, d5lrym_
    automated match to d3rgws_
    complexed with cl, f3s, fco, li, lmt, mg, ni, sf3, sf4, so4; mutant

Details for d5lrys_

PDB Entry: 5lry (more details), 1.4 Å

PDB Description: e coli [nife] hydrogenase hyd-1 mutant e28d
PDB Compounds: (S:) Hydrogenase-1 small chain

SCOPe Domain Sequences for d5lrys_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lrys_ e.19.1.0 (S:) automated matches {Escherichia coli [TaxId: 199310]}
pripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedii
tqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqaa
rpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfygq
rihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpiq
sghgclgcaengfwdrgsfysrv

SCOPe Domain Coordinates for d5lrys_:

Click to download the PDB-style file with coordinates for d5lrys_.
(The format of our PDB-style files is described here.)

Timeline for d5lrys_: