Lineage for d5gw9a_ (5gw9 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705449Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 2705528Protein automated matches [190263] (1 species)
    not a true protein
  7. 2705529Species Human (Homo sapiens) [TaxId:9606] [187052] (14 PDB entries)
  8. 2705530Domain d5gw9a_: 5gw9 A: [338900]
    automated match to d1cd9c_

Details for d5gw9a_

PDB Entry: 5gw9 (more details), 1.65 Å

PDB Description: crystal structure of c163, a backbone circularized g-csf
PDB Compounds: (A:) granulocyte colony-stimulating factor

SCOPe Domain Sequences for d5gw9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gw9a_ a.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqsfllksleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplsscpsqal
qlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmeelgmapa
lqptqgampafasafqrraggvlvashlqsflevsyrvlrhlg

SCOPe Domain Coordinates for d5gw9a_:

Click to download the PDB-style file with coordinates for d5gw9a_.
(The format of our PDB-style files is described here.)

Timeline for d5gw9a_: