Class b: All beta proteins [48724] (180 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) |
Family b.22.1.0: automated matches [191519] (1 protein) not a true family |
Protein automated matches [190873] (4 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [320477] (4 PDB entries) |
Domain d5h49b_: 5h49 B: [338892] automated match to d2wnvb_ complexed with nag |
PDB Entry: 5h49 (more details), 2.8 Å
SCOPe Domain Sequences for d5h49b_:
Sequence, based on SEQRES records: (download)
>d5h49b_ b.22.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} sakvafsairstnhepsemsnrtmiiyfdqvlvnignnfdserstfiaprkgiysfnfhv vkvynrqtiqvslmlngwpvisafagdqdvtreaasngvliqmekgdraylklergnlmg gwkystfsgflvfpl
>d5h49b_ b.22.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} sakvafsairstnhepsetmiiyfdqvlvnignnfdserstfiaprkgiysfnfhvvkvq tiqvslmlngwpvisafagdqdvtreaasngvliqmekgdraylklergnlmggwkystf sgflvfpl
Timeline for d5h49b_: