Lineage for d5gvib_ (5gvi B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2501112Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2501389Protein Ubiquitin [54238] (9 species)
  7. 2501930Species Mouse (Mus musculus) [TaxId:10090] [190020] (9 PDB entries)
  8. 2501941Domain d5gvib_: 5gvi B: [338887]
    automated match to d2k39a_
    complexed with zn

Details for d5gvib_

PDB Entry: 5gvi (more details), 1.87 Å

PDB Description: zebrafish usp30 in complex with lys6-linked diubiquitin
PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d5gvib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gvib_ d.15.1.1 (B:) Ubiquitin {Mouse (Mus musculus) [TaxId: 10090]}
mqifvrtltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg

SCOPe Domain Coordinates for d5gvib_:

Click to download the PDB-style file with coordinates for d5gvib_.
(The format of our PDB-style files is described here.)

Timeline for d5gvib_: