SCOPe 2.06: Domain d5h4ba_: 5h4b A:

Lineage for d5h4ba_ (5h4b A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.0: automated matches [191519] (1 protein)
   not a true family

6. Protein automated matches [190873] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [271469] (8 PDB entries)

8. Domain d5h4ba_: 5h4b A: [338881]
   automated match to d4qpya_
   complexed with nag

Details for d5h4ba_

PDB Entry: 5h4b, 2.8 Å

PDB Description: crystal structure of cbln4

PDB Compounds: (A:) Cerebellin-4

SCOPe Domain Sequences for d5h4ba_:

Sequence; same for both SEQRES and ATOM records:

>d5h4ba_ b.22.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aanskvafsavrstnhepsemsnktriiyfdqilvnvgnfftlesvfvaprkgiysfsfh
vikvyqsqtiqvnlmlngkpvisafagdkdvtreaatngvllyldkedkvylklekgnll
ggwqystfsgflvfpl

Timeline for d5h4ba_:

• d5h4ba_ is new in SCOPe 2.06-stable
  
• d5h4ba_ appears in SCOPe 2.07
  
• d5h4ba_ appears in the current release, SCOPe 2.08