Lineage for d5gvyb_ (5gvy B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079052Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2079092Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2079227Family b.77.3.0: automated matches [191397] (1 protein)
    not a true family
  6. 2079228Protein automated matches [190516] (4 species)
    not a true protein
  7. 2079256Species Oryza sativa [TaxId:39946] [338879] (1 PDB entry)
  8. 2079258Domain d5gvyb_: 5gvy B: [338880]
    automated match to d1x1va_
    complexed with man

Details for d5gvyb_

PDB Entry: 5gvy (more details)

PDB Description: crystal structure of salt protein from oryza sativa
PDB Compounds: (B:) Salt stress-induced protein

SCOPe Domain Sequences for d5gvyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gvyb_ b.77.3.0 (B:) automated matches {Oryza sativa [TaxId: 39946]}
mtlvkiglwggnggsaqdisvppkkllgvtiyssdairsiafnyigvdgqeyaigpwggg
egtsteiklgssehikeisgthgpvydladivtylkivtsanntyeagvpngkefsiplq
dsghvvgffgrsgtlidaigiyvhp

SCOPe Domain Coordinates for d5gvyb_:

Click to download the PDB-style file with coordinates for d5gvyb_.
(The format of our PDB-style files is described here.)

Timeline for d5gvyb_: