Class b: All beta proteins [48724] (180 folds) |
Fold b.77: beta-Prism I [51091] (4 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) |
Family b.77.3.0: automated matches [191397] (1 protein) not a true family |
Protein automated matches [190516] (5 species) not a true protein |
Species Oryza sativa [TaxId:39946] [338879] (1 PDB entry) |
Domain d5gvyb_: 5gvy B: [338880] automated match to d1x1va_ complexed with man |
PDB Entry: 5gvy (more details), 1.66 Å
SCOPe Domain Sequences for d5gvyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gvyb_ b.77.3.0 (B:) automated matches {Oryza sativa [TaxId: 39946]} mtlvkiglwggnggsaqdisvppkkllgvtiyssdairsiafnyigvdgqeyaigpwggg egtsteiklgssehikeisgthgpvydladivtylkivtsanntyeagvpngkefsiplq dsghvvgffgrsgtlidaigiyvhp
Timeline for d5gvyb_: