SCOPe 2.06: Domain d6apea1: 6ape A:5-125

Lineage for d6apea1 (6ape A:5-125)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (29 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:563041] [338876] (1 PDB entry)

8. Domain d6apea1: 6ape A:5-125 [338877]
   Other proteins in same PDB: d6apea2
   automated match to d4cjxb1
   complexed with gol, na

Details for d6apea1

PDB Entry: 6ape, 1.45 Å

PDB Description: crystal structure of bifunctional protein fold from helicobacter pylori

PDB Compounds: (A:) Bifunctional protein folD

SCOPe Domain Sequences for d6apea1:

Sequence; same for both SEQRES and ATOM records:

>d6apea1 c.58.1.0 (A:5-125) automated matches {Helicobacter pylori [TaxId: 563041]}
gvvlldgqalaysiekdlknkiqiitvqvhkrpklavilvgkdpasityvnmkikacerv
gmdfdlktlqenvteaellslikdyntdqnisgvlvqlplprhidskmvleaidpskdvd
g

Timeline for d6apea1:

• d6apea1 is new in SCOPe 2.06-stable
  
• d6apea1 appears in SCOPe 2.07
  
• d6apea1 appears in the current release, SCOPe 2.08