Lineage for d6apea1 (6ape A:5-125)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 2890748Species Helicobacter pylori [TaxId:563041] [338876] (1 PDB entry)
  8. 2890749Domain d6apea1: 6ape A:5-125 [338877]
    Other proteins in same PDB: d6apea2
    automated match to d4cjxb1
    complexed with gol, na

Details for d6apea1

PDB Entry: 6ape (more details), 1.45 Å

PDB Description: crystal structure of bifunctional protein fold from helicobacter pylori
PDB Compounds: (A:) Bifunctional protein folD

SCOPe Domain Sequences for d6apea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6apea1 c.58.1.0 (A:5-125) automated matches {Helicobacter pylori [TaxId: 563041]}
gvvlldgqalaysiekdlknkiqiitvqvhkrpklavilvgkdpasityvnmkikacerv
gmdfdlktlqenvteaellslikdyntdqnisgvlvqlplprhidskmvleaidpskdvd
g

SCOPe Domain Coordinates for d6apea1:

Click to download the PDB-style file with coordinates for d6apea1.
(The format of our PDB-style files is described here.)

Timeline for d6apea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6apea2