Lineage for d5v2ce_ (5v2c E:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254945Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 2254946Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 2254947Protein Cytochrome b559 subunit alpha, PsbE [161047] (2 species)
  7. 2254951Species Thermosynechococcus vulcanus [TaxId:32053] [189913] (10 PDB entries)
  8. 2254957Domain d5v2ce_: 5v2c E: [338872]
    Other proteins in same PDB: d5v2ca_, d5v2cb_, d5v2cc_, d5v2cd_, d5v2cf_, d5v2ch_, d5v2ci_, d5v2cj_, d5v2ck_, d5v2cl_, d5v2cm_, d5v2co1, d5v2co2, d5v2ct_, d5v2cu_, d5v2cv_, d5v2cx_, d5v2cz_
    automated match to d2axte1
    complexed with 1pe, 2pe, bcr, bct, ca, cl, cla, dgd, edo, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, p6g, pg4, pge, pho, pl9, sqd

Details for d5v2ce_

PDB Entry: 5v2c (more details), 1.9 Å

PDB Description: re-refinement of crystal structure of photosystem ii complex
PDB Compounds: (E:) Cytochrome b559 subunit alpha

SCOPe Domain Sequences for d5v2ce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v2ce_ f.23.38.1 (E:) Cytochrome b559 subunit alpha, PsbE {Thermosynechococcus vulcanus [TaxId: 32053]}
ttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsi
plvtdrfeakqqvetfleqlk

SCOPe Domain Coordinates for d5v2ce_:

Click to download the PDB-style file with coordinates for d5v2ce_.
(The format of our PDB-style files is described here.)

Timeline for d5v2ce_: