SCOPe 2.07: Domain d5v2cu_: 5v2c U:

Lineage for d5v2cu_ (5v2c U:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.2: PsbU-like [158539] (2 proteins)
   Pfam PF06514

6. Protein automated matches [191005] (3 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [329396] (5 PDB entries)

8. Domain d5v2cu_: 5v2c U: [338864]
   Other proteins in same PDB: d5v2ca_, d5v2cb_, d5v2cc_, d5v2cd_, d5v2ce_, d5v2cf_, d5v2ch_, d5v2ci_, d5v2cj_, d5v2ck_, d5v2cl_, d5v2cm_, d5v2co1, d5v2co2, d5v2ct_, d5v2cv_, d5v2cx_, d5v2cz_
   automated match to d2axtu1
   complexed with 1pe, 2pe, bcr, bct, ca, cl, cla, dgd, edo, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, p6g, pg4, pge, pho, pl9, sqd

Details for d5v2cu_

PDB Entry: 5v2c, 1.9 Å

PDB Description: re-refinement of crystal structure of photosystem ii complex

PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d5v2cu_:

Sequence; same for both SEQRES and ATOM records:

>d5v2cu_ a.60.12.2 (U:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

Timeline for d5v2cu_:

• d5v2cu_ first appeared in SCOPe 2.06
  
• d5v2cu_ appears in the current release, SCOPe 2.08