Lineage for d5v2cu_ (5v2c U:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001966Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2002201Family a.60.12.2: PsbU-like [158539] (2 proteins)
    Pfam PF06514
  6. 2002213Protein automated matches [191005] (3 species)
    not a true protein
  7. 2002223Species Thermosynechococcus vulcanus [TaxId:32053] [329396] (3 PDB entries)
  8. 2002225Domain d5v2cu_: 5v2c U: [338864]
    Other proteins in same PDB: d5v2ca_, d5v2cb_, d5v2cc_, d5v2cd_, d5v2ce_, d5v2cf_, d5v2ch_, d5v2ci_, d5v2cj_, d5v2ck_, d5v2cl_, d5v2cm_, d5v2co1, d5v2co2, d5v2ct_, d5v2cv_, d5v2cx_, d5v2cz_
    automated match to d2axtu1
    complexed with 1pe, 2pe, bcr, bct, ca, cl, cla, dgd, edo, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, p6g, pg4, pge, pho, pl9, sqd

Details for d5v2cu_

PDB Entry: 5v2c (more details), 1.9 Å

PDB Description: re-refinement of crystal structure of photosystem ii complex
PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d5v2cu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v2cu_ a.60.12.2 (U:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d5v2cu_:

Click to download the PDB-style file with coordinates for d5v2cu_.
(The format of our PDB-style files is described here.)

Timeline for d5v2cu_: