SCOPe 2.06: Domain d5y3ca1: 5y3c A:356-437

Lineage for d5y3ca1 (5y3c A:356-437)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (22 species)
   not a true protein

7. Species Danio rerio [TaxId:7955] [338846] (1 PDB entry)

8. Domain d5y3ca1: 5y3c A:356-437 [338847]
   Other proteins in same PDB: d5y3ca2
   automated match to d1wspa1

Details for d5y3ca1

PDB Entry: 5y3c, 1.96 Å

PDB Description: crystal structure of zebrafish ccd1 dix domain

PDB Compounds: (A:) Dixin-A

SCOPe Domain Sequences for d5y3ca1:

Sequence; same for both SEQRES and ATOM records:

>d5y3ca1 d.15.1.0 (A:356-437) automated matches {Danio rerio [TaxId: 7955]}
aaastkvlyytdrsltpflvnipkrlgdvtlqdfkaavdrhgsfryhfksldpefgtvke
evfqddavipgwegkivawvee

Timeline for d5y3ca1:

• d5y3ca1 is new in SCOPe 2.06-stable
  
• d5y3ca1 appears in SCOPe 2.07
  
• d5y3ca1 appears in the current release, SCOPe 2.08