Lineage for d5y3ca1 (5y3c A:356-437)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (26 species)
    not a true protein
  7. 2502904Species Zebrafish (Danio rerio) [TaxId:7955] [338846] (3 PDB entries)
  8. 2502905Domain d5y3ca1: 5y3c A:356-437 [338847]
    Other proteins in same PDB: d5y3ca2
    automated match to d1wspa1

Details for d5y3ca1

PDB Entry: 5y3c (more details), 1.96 Å

PDB Description: crystal structure of zebrafish ccd1 dix domain
PDB Compounds: (A:) Dixin-A

SCOPe Domain Sequences for d5y3ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y3ca1 d.15.1.0 (A:356-437) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
aaastkvlyytdrsltpflvnipkrlgdvtlqdfkaavdrhgsfryhfksldpefgtvke
evfqddavipgwegkivawvee

SCOPe Domain Coordinates for d5y3ca1:

Click to download the PDB-style file with coordinates for d5y3ca1.
(The format of our PDB-style files is described here.)

Timeline for d5y3ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5y3ca2