Lineage for d5x5ja_ (5x5j A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2438295Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2438674Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2438675Protein automated matches [190131] (75 species)
    not a true protein
  7. 2438676Species Acinetobacter baumannii [TaxId:470] [328556] (3 PDB entries)
  8. 2438677Domain d5x5ja_: 5x5j A: [338830]
    automated match to d2mska_

Details for d5x5ja_

PDB Entry: 5x5j (more details), 1.4 Å

PDB Description: crystal structure of response regulator ader receiver domain
PDB Compounds: (A:) AdeR

SCOPe Domain Sequences for d5x5ja_:

Sequence, based on SEQRES records: (download)

>d5x5ja_ c.23.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
cqdkvilvveddydigdiienylkregmsviramngkqaielhasqpidlilldiklpel
ngwevlnkirqkaqtpvimltaldqdidkvmalrigaddfvvkpfnpneviarvqavlrr

Sequence, based on observed residues (ATOM records): (download)

>d5x5ja_ c.23.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
cqdkvilvveddydigdiienylkregmsviramngkqaielhasqpidlilldiklpel
ngwevlnkirqkaqtpvimltaldidkvmalrigaddfvvkpfnpneviarvqavlrr

SCOPe Domain Coordinates for d5x5ja_:

Click to download the PDB-style file with coordinates for d5x5ja_.
(The format of our PDB-style files is described here.)

Timeline for d5x5ja_: