Lineage for d5whka2 (5whk A:177-270)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1180 PDB entries)
  8. 2356840Domain d5whka2: 5whk A:177-270 [338827]
    Other proteins in same PDB: d5whka1, d5whkb_, d5whkl2
    automated match to d3frua1
    complexed with edo, nhe

Details for d5whka2

PDB Entry: 5whk (more details), 2.5 Å

PDB Description: crystal structure of fab fragment of antibody dx-2507 bound to fcrn- b2m
PDB Compounds: (A:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d5whka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5whka2 b.1.1.0 (A:177-270) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha
sssltvksgdehhyccivqhaglaqplrvelesp

SCOPe Domain Coordinates for d5whka2:

Click to download the PDB-style file with coordinates for d5whka2.
(The format of our PDB-style files is described here.)

Timeline for d5whka2: