Lineage for d5whka1 (5whk A:4-176)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507544Species Human (Homo sapiens) [TaxId:9606] [226044] (76 PDB entries)
  8. 2507629Domain d5whka1: 5whk A:4-176 [338826]
    Other proteins in same PDB: d5whka2, d5whkb_, d5whkl1, d5whkl2
    automated match to d3frua2
    complexed with edo, nhe

Details for d5whka1

PDB Entry: 5whk (more details), 2.5 Å

PDB Description: crystal structure of fab fragment of antibody dx-2507 bound to fcrn- b2m
PDB Compounds: (A:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d5whka1:

Sequence, based on SEQRES records: (download)

>d5whka1 d.19.1.0 (A:4-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hlsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvwenqvswywek
ettdlrikeklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlk
qgtwggdwpealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew

Sequence, based on observed residues (ATOM records): (download)

>d5whka1 d.19.1.0 (A:4-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hlsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvswywekettdl
rikeklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlkqgtwg
gdwpealaisqrwqqqdkaankeltfllfscphrlrehlw

SCOPe Domain Coordinates for d5whka1:

Click to download the PDB-style file with coordinates for d5whka1.
(The format of our PDB-style files is described here.)

Timeline for d5whka1: