Lineage for d1b26c2 (1b26 C:4-178)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) 
Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins) 
Protein Glutamate dehydrogenase [53225] (6 species) 
Species Thermotoga maritima [TaxId:243274] [53229] (3 PDB entries) 
Domain d1b26c2: 1b26 C:4-178 [33882]
Other proteins in same PDB: d1b26a1, d1b26b1, d1b26c1, d1b26d1, d1b26e1, d1b26f1
Details for d1b26c2
PDB Entry: 1b26 (more details), 3 Å
PDB Description: glutamate dehydrogenase
SCOP Domain Sequences for d1b26c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b26c2 c.58.1.1 (C:4-178) Glutamate dehydrogenase {Thermotoga maritima}
slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrnelerls
rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvel
SCOP Domain Coordinates for d1b26c2:
Click to download the PDB-style file with coordinates for d1b26c2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b26c2:
View in 3D
