Lineage for d5wqja2 (5wqj A:152-296)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876007Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2876008Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) (S)
    Pfam PF00581
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 2876105Family c.46.1.0: automated matches [227256] (1 protein)
    not a true family
  6. 2876106Protein automated matches [227041] (2 species)
    not a true protein
  7. 2876117Species Mouse (Mus musculus) [TaxId:10090] [338807] (2 PDB entries)
  8. 2876119Domain d5wqja2: 5wqj A:152-296 [338819]
    automated match to d1rhsa2
    complexed with 7n3, na

Details for d5wqja2

PDB Entry: 5wqj (more details), 1.2 Å

PDB Description: crystal structure of 3-mercaptopyruvate sulfurtransferase(3mst) in complex with compound1
PDB Compounds: (A:) sulfurtransferase

SCOPe Domain Sequences for d5wqja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wqja2 c.46.1.0 (A:152-296) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aefsaqldpsfikthedilenldarrfqvvdaraagrfqgtqpeprdgiepghipgsvni
pftefltneglekspeeikrlfkekkvdlskplvatcgsgvtashvvlgaflsgksdvpv
ydgswvewymraqpehiisegrgkt

SCOPe Domain Coordinates for d5wqja2:

Click to download the PDB-style file with coordinates for d5wqja2.
(The format of our PDB-style files is described here.)

Timeline for d5wqja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5wqja1