SCOPe 2.08: Domain d5wqja1: 5wqj A:5-151

Lineage for d5wqja1 (5wqj A:5-151)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.0: automated matches [227256] (1 protein)
   not a true family

6. Protein automated matches [227041] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [338807] (2 PDB entries)

8. Domain d5wqja1: 5wqj A:5-151 [338818]
   automated match to d1rhsa1
   complexed with 7n3, na

Details for d5wqja1

PDB Entry: 5wqj, 1.2 Å

PDB Description: crystal structure of 3-mercaptopyruvate sulfurtransferase(3mst) in complex with compound1

PDB Compounds: (A:) sulfurtransferase

SCOPe Domain Sequences for d5wqja1:

Sequence, based on SEQRES records:

>d5wqja1 c.46.1.0 (A:5-151) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qlfralvsaqwvaealkaprssqplklldaswylpklgrdarrefeerhipgaaffdidr
ssdhtspydhmlpnathfadyagslgvsaathvviydgsdqglysaprvwwmfrafghhs
vslldggfrhwlnqnlpissgkshsep

Sequence, based on observed residues (ATOM records):

>d5wqja1 c.46.1.0 (A:5-151) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qlfralvsaqwvaealkaqplklldaswylpklgrdarrefeerhipgaaffdidrssdh
tspydhmlpnathfadyagslgvsaathvviydgsdqglysaprvwwmfrafghhsvsll
dggfrhwlnqnlpissgkshsep

Timeline for d5wqja1:

• d5wqja1 first appeared in SCOPe 2.06
  
• d5wqja1 appears in SCOPe 2.07