Lineage for d5whkl2 (5whk L:112-212)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (15 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (888 PDB entries)
  8. 2353302Domain d5whkl2: 5whk L:112-212 [338815]
    Other proteins in same PDB: d5whka1, d5whka2, d5whkb_, d5whkl1
    automated match to d2fb4l2
    complexed with edo, nhe

Details for d5whkl2

PDB Entry: 5whk (more details), 2.5 Å

PDB Description: crystal structure of fab fragment of antibody dx-2507 bound to fcrn- b2m
PDB Compounds: (L:) DX-2507 Fab light chain

SCOPe Domain Sequences for d5whkl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5whkl2 b.1.1.2 (L:112-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d5whkl2:

Click to download the PDB-style file with coordinates for d5whkl2.
(The format of our PDB-style files is described here.)

Timeline for d5whkl2: