![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
![]() | Superfamily f.17.5: PsbZ-like [161055] (2 families) ![]() automatically mapped to Pfam PF01737 |
![]() | Family f.17.5.1: PsbZ-like [161056] (1 protein) Pfam PF01737; Ycf9 |
![]() | Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (30 PDB entries) |
![]() | Domain d5v2cz_: 5v2c Z: [338813] Other proteins in same PDB: d5v2ca_, d5v2cb_, d5v2cc_, d5v2cd_, d5v2ce_, d5v2cf_, d5v2ch_, d5v2ci_, d5v2cj_, d5v2ck_, d5v2cl_, d5v2cm_, d5v2co1, d5v2co2, d5v2ct_, d5v2cu_, d5v2cv_, d5v2cx_ automated match to d4pj0z_ complexed with 1pe, 2pe, bcr, bct, ca, cl, cla, dgd, edo, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, p6g, pg4, pge, pho, pl9, sqd |
PDB Entry: 5v2c (more details), 1.9 Å
SCOPe Domain Sequences for d5v2cz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v2cz_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]} mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff vv
Timeline for d5v2cz_: